SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T009749 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T009749
Domain Number 1 Region: 85-149
Classification Level Classification E-value
Superfamily AN1-like Zinc finger 5.76e-26
Family AN1-like Zinc finger 0.00028
Further Details:      
 
Domain Number 2 Region: 10-45
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000067
Family A20-like zinc finger 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PYU1_T009749
Sequence length 160
Comment protein Name="PYU1_T009749" Note="Similar to Zfand5: AN1-type zinc finger protein 5 (Mus musculus)" AED:0.255070993914807 QI:0|-1|0|1|-1|1|1|0|160
Sequence
MQQERESAELCANGCGFFGAPASGGMCSVCWKKTMSKRAVGTSASASPAKTDAPRAETAD
AGNNNDVAVAESVEAVAPVAAAAAGEEEPAKLVQKNKNRCWECKKKVGLTAIECRCGYVF
CSNHRYADQHSCSFDFKAADRAELARRNPGGGQFGKLEKL
Download sequence
Identical sequences K3WXQ1
PYU1_T009749

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]