SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T009766 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T009766
Domain Number 1 Region: 85-331
Classification Level Classification E-value
Superfamily MurD-like peptide ligases, catalytic domain 1.6e-75
Family Folylpolyglutamate synthetase 0.0000574
Further Details:      
 
Domain Number 2 Region: 372-438,504-562
Classification Level Classification E-value
Superfamily MurD-like peptide ligases, peptide-binding domain 0.000000000879
Family Folylpolyglutamate synthetase, C-terminal domain 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PYU1_T009766
Sequence length 566
Comment protein Name="PYU1_T009766" Note="Similar to FPGS: Folylpolyglutamate synthase, mitochondrial (Bos taurus)" AED:0.141975308641975 QI:0|-1|0|1|-1|1|1|0|566
Sequence
MTQLVLPPAAPVLAAADPSASTSPLLGSEVLRNVSGDKEKPLVEDEKSLSDQVQEAMTKL
LGVSSQFKDLNGQDHNVSTREETIAMMQHYLKRLELTDAVNSKLSVIHIAGTKGKGSTCA
MVERILREAGYKTGLFTSPHLITPCERFRINGKPIAESVFLRHFYAIWNGLESTADQSDE
YPPMAWFFRFLTLLALHLFVDEQVDVVILEVGIGGRLDATNVIPKPVACGITTLDLDHTR
VLGDTLDQIAYAKGGIIKKDVPAFTCAQDPLAMEMLEKCAAESHTRLFPVPSIDAFGPDG
KTSVLGMRGDYQRVNAGLAVALASTWLKQRRGEPLSESFDYSQLLEPAVRDGLKNAFWPA
RSHLMEDLDHYTRFYIDGAHTLKSLEVCAEWFSQMTAKKQSSPANKRVLIFTIHHERNVA
SIIASLLQIPFDRVYFCKTSASRPSQAKVHTFSESLECANLGHLLSNYTDEEIRALDTVE
GKLQYQMTLSRIWHALKTHLIKEDQTHRTIAVRDSVVDCINELRAGTEESKANHSFDATE
EEQWSILTTGSLYLAGETLDFLQWRE
Download sequence
Identical sequences K3WXR8
PYU1_T009766

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]