SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T009815 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T009815
Domain Number 1 Region: 32-126
Classification Level Classification E-value
Superfamily SMAD/FHA domain 0.00000000023
Family FHA domain 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PYU1_T009815
Sequence length 246
Comment protein Name="PYU1_T009815" Note="Similar to fhl1: Fork head transcription factor 1 (Schizosaccharomyces pombe)" AED:0.0813559322033899 QI:0|0.5|0.33|1|1|1|3|0|246
Sequence
MAALEEKKKALEKKFVESRPPLAYAKISGRVHDDVPFEMLITHLPTELGRGPLSTSPGPK
ISLGEQKALSRQHARIQWNQEKSGFELEVLGKNGMFASGKYIGKDKKVDLVSKMPLKIGP
ARIYFLAAVRSVCSTMSGFKLVQRAFEKTKSLGKGQDGMTAEEVVQQIMDCFPRSEDELG
GKANLREFVTNYLELDTQNFQKTSGSSPPRYKMLPTATSTATTPASLSTTATSETAKKKQ
KVDDSK
Download sequence
Identical sequences K3WXW7
PYU1_T009815

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]