SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T009870 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T009870
Domain Number 1 Region: 7-137
Classification Level Classification E-value
Superfamily DOPA-like 4.05e-23
Family DOPA dioxygenase-like 0.001
Further Details:      
 
Domain Number 2 Region: 270-334
Classification Level Classification E-value
Superfamily Homeodomain-like 0.000000000278
Family Centromere-binding 0.0084
Further Details:      
 
Weak hits

Sequence:  PYU1_T009870
Domain Number - Region: 430-467
Classification Level Classification E-value
Superfamily DOPA-like 0.012
Family DOPA dioxygenase-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PYU1_T009870
Sequence length 491
Comment protein Name="PYU1_T009870" Note="Similar to DODA: DOPA 4,5-dioxygenase (Amanita muscaria)" AED:0.184641879141304 QI:0|0|0|0.4|0.75|0.6|5|0|491
Sequence
MAVTKGEEIKEWHFHVYWLENRSEKGFAQADALRLKLLERVEKDPKFIAVFHGISSAQYP
ALLDTPPPMNRTPVGPHPSGSFEVWVPKESFVKVLSFFMFHRGSLSIFLHPLTKDQRIDH
SSARAVWLGPSWPIDGTALPEDPTEEDADPPFQFDIQAATSSSSLEQMPRIKTTRVNSRP
GPPAKTAGVANAPKPAKRSRSQVTVKEKLAVIDWYHQNGRNQEKTAEYFRHAEGFHTFSQ
STVSRWLKEEENLRKRYEEGSRQRIRTVPVKHPALEEHLSAWIDHTQQQQETRVTGDQIK
AAASQFYDERGTPHEERLNLSNGWLGKFKQRHQLQQIRSHSEAGTSSADAATNTAHMTAI
PVAATAEQSSRKRNDVRNVLNPSEEPLHISSNTRQSSKKSTKTSKKVQRPTRSQTRTSVR
SARMLAAIEDDEIKEWHFHVYWLENGSDHGFAKADALRLKLLERVEKDPKFIAVFHGEAC
FSKIISRSAGL
Download sequence
Identical sequences K3WY22
PYU1_T009870

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]