SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T009920 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T009920
Domain Number 1 Region: 291-373
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.0000000000217
Family Canonical RBD 0.0034
Further Details:      
 
Weak hits

Sequence:  PYU1_T009920
Domain Number - Region: 412-463
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.0549
Family Canonical RBD 0.031
Further Details:      
 
Domain Number - Region: 4-132
Classification Level Classification E-value
Superfamily ARM repeat 0.0655
Family PBS lyase HEAT-like repeat 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PYU1_T009920
Sequence length 1202
Comment protein Name="PYU1_T009920" Note="Similar to SRRM2: Serine/arginine repetitive matrix protein 2 (Homo sapiens)" AED:0.207943068837094 QI:0|0|0|0.5|1|1|4|0|1202
Sequence
MAKATVDLLGELYSWDTKIDDVFALDTADPERDEDDALDAYEEVIGVASQPQQDGADAVL
SLAAQLLAKHFYKFPHVHLNVVDVMLALCGVERQHAVRINTIRSLLQIVKTPTSEAKPMA
RECFDRIREVLAKLVAKETSGVIMRHMTQLTTALKEREEAAATAAKKEDKLAKKQKKRAE
NNTTMTAVVGEKEMPKQKPSPRAQHQPVLQDPPSSSKDYVEREKRQPRGEPTDEHTSKGK
YDDRRSKDESFPSRMDDGDHKQKKYERSDEAPARISDAPARGPPQGGFHGQGCPPGPYLF
IGNVPFDIRNSDISDFLSEVDPTMKSNNVQIKYPPRGGSGYAFVSLPSTELAREAMRFVN
KVKFQGRYLNSNFARGPPCDTLAFVERRKGGNMEDDDAVREFNFAKCHPSVWERLCDVLR
TYGNFDVVEVGKVRFRDVESAKDVIKKHHYIVQGYEIIPIYEPEEQLRNDNTRTRHMQHA
NTTRQGFALKSGRVVGDVGGKHSDDRGRNEDRKSDKYENRHNQPRDDDQGKGQRKGSDSP
KKHVKRQDAPLSEKLKQTRDRSFSRSQSPAVAPSRKQAANSSCARSKSRSPSLAPVRKED
TRENRSKKSRSPAHASRKHDVETRGRSKSRSSSPHRAPSSRKQEYQLRSRSPRKQETRSA
SRSPARASNSNQKIPSQNKQQADRFRSKSPVDDRQATQFENRGGDRGDRGPKSRSRSGER
SHFNSRDIRDVSSYGPGRRGDDGGNGGRFERDQALRTHDQGSEHFRPERRESGAWSSGGG
MARYGPAGNDRKVDSRDDKRNDRATGNREYREYRESPQPQRPAFNNNQHNRNDQQRRRSR
SPPRHRGAEVARSQSPQSRRPVDDPPRRGLGGDNGFRGGRDTRMLERNGSSTSSVSRRDD
DRSIAEIAREALEKQRQMQQMRREQQSSGGYHRHGDGGRIGDHYSTPPSRDHRAPLGNGG
VGFQRNRSRSPVRSAQLQSHQGRHNDLPRDRPPSPPRQTQSREFNRGNGARGSPQFDRPQ
ERRDSFDISRMERRGRSPPPSPFMKPGSRRAPSPPAMERSRAHSSHGQDDDRDRKRDRHS
RRDGHDRSQKEQNRNVANSQRSNKHSNRDRPAPVLDSPPMGKRLRSLTPSPMRRDNNSYR
KHEERNRSPILKRSMDRDDGNGSEKKRRVMQEDDDSIVPPKMTSAVFDDMDETMVDYDED
DD
Download sequence
Identical sequences K3WY71
PYU1_T009920

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]