SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T009966 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T009966
Domain Number 1 Region: 54-138
Classification Level Classification E-value
Superfamily DNA-glycosylase 0.000000506
Family Mismatch glycosylase 0.065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PYU1_T009966
Sequence length 257
Comment protein Name="PYU1_T009966" Note="Protein of unknown function" AED:0.486785070274929 QI:0|0.25|0|0.6|1|1|5|0|257
Sequence
MTLWTSADAGEWATVWARYRDVVASVQKENLVELDEWIQTTLPVVLHERDPKPFITQSEL
VKLMEWKLKKGKWRPSLMKYIENLSAPAVKKASEKALTGLKNGGPLKSAIEALCELKGVG
PATASVVLAAYDNNVPFMGDEALEAIAHIIGARKYTLGHYLNFATQLAEKAKWLNEQQTK
SEDSGDEEGASTWSSQRVQLCLYAAAQDTNGDGQKKKSKAVSPKPKATKSKAATDPDGED
ESEGTKSSRPMRKRRKA
Download sequence
Identical sequences K3WYB7
PYU1_T009966

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]