SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T009972 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T009972
Domain Number 1 Region: 295-404
Classification Level Classification E-value
Superfamily Cyclin-like 0.00000000000000278
Family Cyclin 0.0079
Further Details:      
 
Weak hits

Sequence:  PYU1_T009972
Domain Number - Region: 367-499
Classification Level Classification E-value
Superfamily ARM repeat 0.046
Family Diap1 N-terninal region-like 0.078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PYU1_T009972
Sequence length 565
Comment protein Name="PYU1_T009972" Note="Similar to CABLES1: CDK5 and ABL1 enzyme substrate 1 (Homo sapiens)" AED:0.0903101242103008 QI:0|0.66|0.25|0.75|1|1|4|0|565
Sequence
MASVAGKQQQQQVFFIKASDSPSSVHSERSRHHVHSHSRKVTRDIAALDFLQNIPMRSEL
VAAKEQQAHITDKKSSDQQASPSKIEHEDGSSHSGISDTVVHGTESLAGRRLPGFDATIV
HVPPLFRYRFTTKYPAASAVVRRWEGMTAQQGLLGSRTYFSSGCGYPIATSTIIKYNGNE
TNALRKRFASVGSNLEPMSYDWRGKSYFRLLHATWATCGKDRDSQEDHPVVQPYLPNYLD
DPEFRQGRHRHVVRGDKNIGPIVSSILLFVKPNDLKDELNKKFQEKHAWLTGDRISLSKI
RNLKRETLTSCQRLGLEIATAAMACVYFEKLVLSHYVNKSNRKLYMSVCLLLAAKFNEPK
ASQSMKNAIKKILEEIDQVHSIPSREVLTAEFTVYAQLSFSLHVPLAEIQPHFTRLLKLI
ESNPRKYLDDDVFASYSMLVLDEKNRTAQLHLDAMRSFDGETQDEGTDLEALLSDEDEQL
GVHGDDDDDDLDDEDGQDPSGFSWNRVSFAQWWRNRRVGSTSSAARRETRSASMLASPIR
EEEEETETSNRVASTSFITSSSHDE
Download sequence
Identical sequences K3WYC3
PYU1_T009972

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]