SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T009999 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T009999
Domain Number 1 Region: 177-311
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.0000000000421
Family Synaptotagmin-like (S variant) 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PYU1_T009999
Sequence length 441
Comment protein Name="PYU1_T009999" Note="Protein of unknown function" AED:0.0124434389140271 QI:0|0|0|0.5|0|0|2|0|441
Sequence
MPFLVCFEISEAFYRSPASEFGVDRVIDMYESLYGRLRGTKPRTSAYFAYEELLLVRLSF
LYAQKALDQSAVRYLRSSVKLIDELLSLRRRRNNAHLQSKKPKAIKWPCSLSFPFKLSDA
ELVFVRGFLLEMLEDLKQIPIEKRKSWKDYNVFHMEVMGIASQRMPNIKGKREPTGIRVF
VGQTQDVVIQNMLHSKPFVSIQCEGKTMYSQTTPTWMSLSPSWEEYMEFYVESSKARLVV
SLMDRAKRTSYIGGNQLLGSVQLHMDELCKNPEVYAAGHFFDLVAPALDHHTDFGLPHKC
PKIFLSVQVIFKAPTATRQTKRTAKQMRGNWELGELQSQLHGDLETFIHSRWIWSRFGKL
WFEEQDYSVASWFYSKAVAVVQRNNTSWREHELLHHVHDLMALATCYKATMSNKHWIYYA
LPLIESAGTVIQNAIHAAKSM
Download sequence
Identical sequences K3WYF0
PYU1_T009999

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]