SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T010009 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T010009
Domain Number 1 Region: 272-505
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 5.14e-58
Family DNA replication initiator (cdc21/cdc54) N-terminal domain 0.0005
Further Details:      
 
Domain Number 2 Region: 569-587,616-913
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 8.32e-39
Family Extended AAA-ATPase domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PYU1_T010009
Sequence length 996
Comment protein Name="PYU1_T010009" Note="Similar to MCM4: DNA replication licensing factor MCM4 (Homo sapiens)" AED:0.00752256770310933 QI:0|-1|0|1|-1|1|1|0|996
Sequence
MLTEDTEMAVEDATQPMTIDATVVPSSTTTGFGTSAARSGFAYNRYDDGRPQSPLSPTSP
MSPTSAVSISASAVSATDQPRYTFPEMSASIDATPTPRYLGRFGAGGGYGGGASEPEDDV
EAELRRMAQRQLPRGDLGRQEWRLDNFTPHATAATSSQSYRDMGGAPSSPTSSIRSAASS
AQNESALPRPPASPPSSPRSRSSTTAGGFNGDDFSASHRSPQTASHMPPDSDQNLSGAVV
WGTNISVSESMTLFRAFLHQYQLPGHPPRLRHEEGYYVKVLRQLALTQSLVFNLDTQHLL
QFRSARKLYNQLLLFPQVLIRILDMVVSEEFQKLFPEATEEESRLQVRPFNLSDLSPMRN
LNPSDIDQLVCLKGMVTRCSAIIPDLKEAFFRCTICHATTQVELDRGRIEEPTYCERCNT
RLCMEMIHNRCSFTDKQMVKMQETPDAIPEGETPYTVMLFAFDDLVDDVRPGDKVEVTGI
YRAVPLRASSRQRVVKSVFKTYIDVVHFRRVDELARRGDEQSVGSSENGTLADDSNNIQS
TEEAKIQKFRQIAAHPNVYENLAHSLAPSIWELDDVKKGILCMLFGGTRKDKAGNTSGNS
PGGIDGALMPTKTMRSDMNILLCGDPGTSKSQLLSYVHKLSPRSIYTSGKGSSAVGLTAS
IIRDMETGDLVLESGALVLSDEGICCIDEFDKMSDSARSVLHEVMEQQTVSIAKAGIICS
LNARASILASANPIESRYNPNKSVIENVNILPTLLSRFDLIYLILDKPQAESDRKLAKHI
VALYYDDDIRTLRQNNASANGSGPQLISMKLLTEYISYAKKHIQPRLLPEARDALIAAYL
DLRRMGGGSAHASKKNITATPRQLESLIRISEALAKMKLNNVIYKHDVDEALRLMNVATQ
RAAMDPRTGTIDMDMINTGHSTSEREAIADIIDAMKAILSDAPGQSMTVGETRKFLEEKR
HGELKGTEFQMALRSLEEDSLIQISHGLIRYFGDAA
Download sequence
Identical sequences K3WYG0
PYU1_T010009

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]