SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T010021 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T010021
Domain Number 1 Region: 155-229
Classification Level Classification E-value
Superfamily Surp module (SWAP domain) 4.19e-18
Family Surp module (SWAP domain) 0.00026
Further Details:      
 
Domain Number 2 Region: 17-78
Classification Level Classification E-value
Superfamily Surp module (SWAP domain) 2.35e-17
Family Surp module (SWAP domain) 0.00031
Further Details:      
 
Domain Number 3 Region: 634-735
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000000000000101
Family Ubiquitin-related 0.00035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PYU1_T010021
Sequence length 736
Comment protein Name="PYU1_T010021" Note="Similar to SF3A1: Splicing factor 3 subunit 1 (Bos taurus)" AED:0.383310719131615 QI:0|0|0|0.33|1|1|3|0|736
Sequence
MADGDANDATATAQGRVTGLIVPPPDIRAVVDKTAQFVARNGRSFERKIAGETVSAKFSF
LKPSDPYHAYYEHKVSEWIEQNAQEAENPTVAQEEAQEAEPAAAPSAPEAPAAAETAEPA
ATDEPADPVNALVVVEKKAVETVTAKVAKKLKEKALTPPEPEKFKIKHPQLSALDQEIMY
LTAQYTALSGKTFLAGLATREQRNPQFDFLKPTHALFAYFTALVESYTQVLAPTRENDEQ
QQQMKRIEEGMDRMKVLDRCVHKLEWVRTEQERKDAEAAESDAERLALAQIDWHDFVVVE
TITLDDAEEEEAAAAAAAAQAEADKGSDDDMDMDEDSDNDDADGAKPDIKVVEDYVPLAS
SSTAATSQPLLTVDGKTVSSAEANEHMRILLMNPKWREETQRHLEKQKESSYAAGTAIAD
SLRRFATKRADIFASSAEEEARLLQATSTPAPGAAFASQQDEMDDDGDDDEQQQQQQQPG
PSTAGAPGAPGAAPGPFGQPPAQFQTPGYSGALMQHGLPPGVAPGMTGPPGTMGPPGMMM
SAPGMRGPPGVGGPPGVARPPPGIMMMGPPGVSGMPPGLSGPPGVPPGVSGPPGVSMPGP
PGAPGTAPGTSAPQSTDDSEPAAKRQRTDATPTLLPEAEFAALHPGTVRLVVNVPQEPEH
SQWKLEGQTLSIEVDIKDNIRTVKEKIMSELNGMPVNKQQLKIPVGFLKDTLTCAHYNFV
NGTPLELSVRQRGGRR
Download sequence
Identical sequences K3WYH2
PYU1_T010021

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]