SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T010057 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T010057
Domain Number 1 Region: 59-260
Classification Level Classification E-value
Superfamily Ribosomal protein L1 4.97e-74
Family Ribosomal protein L1 0.00000113
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PYU1_T010057
Sequence length 275
Comment protein Name="PYU1_T010057" Note="Similar to rplA: 50S ribosomal protein L1 (Dinoroseobacter shibae (strain DFL 12))" AED:0.303884952486823 QI:0|1|0.33|1|1|1|3|85|275
Sequence
MRVLLLINAKAHATRAAPCWARSASTAVEGVANARSTRSPTALGLKPRNTGLPQVEEDIK
SAIAKLKQSTRKFDETIDIAVQLGVDPRKPNQSVRGVVSLPNGTGKTVRVAVFARGPKAE
EAKAAGATIVGAEDLVELVQSGKLEFDRCIATPDVMPLVGRVARILGPRGLMPNPKLGTV
TLDVADAISAAKGGQVEFRAEKKGIIHAGIGKASFSEEALLENVRAFMVALGDAKPEGAK
GKYIKAAHLSSTMGPGLALDAKQIDPSSAFFMRFD
Download sequence
Identical sequences K3WYK8
PYU1_T010057

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]