SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T010111 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T010111
Domain Number 1 Region: 4-355
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 8.5e-106
Family Motor proteins 0.0000000529
Further Details:      
 
Domain Number 2 Region: 449-574
Classification Level Classification E-value
Superfamily SMAD/FHA domain 0.0000000000000452
Family FHA domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PYU1_T010111
Sequence length 636
Comment protein Name="PYU1_T010111" Note="Similar to kif1: Kinesin-related protein 1 (Dictyostelium discoideum)" AED:0.438486247830532 QI:0|0.41|0.23|0.61|0.83|0.76|13|0|636
Sequence
MADNVQVAVRVRPFNEREKHLQSTSCIRMTKETQQTVITDPETNAEKAFTFDYSYNSFAD
PDDLDHASQDTVWDDIGVKVLEHAWNGFNVSLFAYGQTGSGKSFSMVGYGSERGIIPRAS
EVIFERIEANTTDISFKVEASMMEIYNERVKDLFNPALDNLKIRDHPRQGPYAEGLTRSA
VSTHKEISRLMDAGILARTTASTNMNATSSRAHTIFQIISELNQASGKVLEKVSRINLID
LAGSERAASTGATGSRLKEGAAINQSLSALGNCISALADLANGKKKVLVPYRNSKLTHLL
KDSLGGNSKTIMIAALSPASVNYSIKNQAVVNEDPNQLLIRQLKEELKALRKAMMENVGS
RPNSREYGDSAVDDDGFCPASINPAREKEVASIKEQLEEHQRLLRESEKTWTERLKETEE
LARKREEQLKMLGLVSNTSDLKSKSMMEPHLLNLNEDQLMTEKLLYFLNFGDNKVGRIDA
EEEQSIVIGGLSILKEHCVITRKKRTDSSVAANSTEHDEERQLDEAIAEQDVLLIRANPG
AKVYINATMISEDSEVQLRHCDRLILGNANVFRVVIPSARSANADPEELASESLFDWQLA
MKELNSSQIKANLELEEMAEKEKAEMDARVKKMEEM
Download sequence
Identical sequences K3WYR2
PYU1_T010111

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]