SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T010117 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T010117
Domain Number 1 Region: 140-271
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 8.02e-19
Family Synaptotagmin-like (S variant) 0.051
Further Details:      
 
Domain Number 2 Region: 26-142
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.47e-18
Family Synaptotagmin-like (S variant) 0.031
Further Details:      
 
Domain Number 3 Region: 300-496
Classification Level Classification E-value
Superfamily vWA-like 0.0000000000000645
Family Integrin A (or I) domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PYU1_T010117
Sequence length 558
Comment protein Name="PYU1_T010117" Note="Similar to Cpne2: Copine-2 (Mus musculus)" AED:0.033129175946548 QI:0|0.57|0.37|1|1|1|8|0|558
Sequence
MYAAAAPSAAYGASSRVPTSRVELSLSAKNLKDRDVLSKSDPFAVLSQFDGRGWIEIGRT
EPLEDNLSPAWTKLFLVDYYFESQQQLKVDIYDEDSSSKKLSEHDYIGGTSFTLGQVMGA
PGQSGSFLLTRGKHHGSHRGSLLVKAEEAKNTNEVVRLRFAGSNLPNMDGMFGKSDPFLV
IKRLREDNSSWMPVHKTEVIDNNLNPNWRVFELPLQQLCNGDYRRPLQLQVFDQDRGSKH
ELIGSVDTLIAKRGTNYVLHNEELHRKKGKKYTNAGLLIAHDVDVMRLPSFVEFLRGGLE
MSLIIGIDYTASNGAISDPHSLHFLDPRGPNQYQHAVSATASILQEYDSDKMIPVYGFGG
IPPGAHSVDHCFPLNLNPPNPEVYGAQGVLQLYTSSLPYIRLHGPTIIQQTMAIAQSSAD
PRKQKYFVLLIITDGAIMDMPTTIDTLVQAANTTPLSIVIIGVGPADFSSMNALDGDGKV
LRDSRGRPSTRDIVQFVPYNRFAHDPSLLTRETLAEIPNQLCQYMRVRGINPNPAIAPSF
KAFEPPAAGASVAWMRLQ
Download sequence
Identical sequences K3WYR8
PYU1_T010117

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]