SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T010118 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T010118
Domain Number 1 Region: 5-50
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0000412
Family Psq domain 0.029
Further Details:      
 
Weak hits

Sequence:  PYU1_T010118
Domain Number - Region: 294-344
Classification Level Classification E-value
Superfamily Homeodomain-like 0.000133
Family Psq domain 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PYU1_T010118
Sequence length 550
Comment protein Name="PYU1_T010118" Note="Similar to SRP40: Suppressor protein SRP40 (Saccharomyces cerevisiae)" AED:0.17967332123412 QI:0|-1|0|1|-1|1|1|0|550
Sequence
MPRASTVSEKVWAQAIHAVSVQKMSLRRAAQLYGVHHMSLHRRVRGQYLGATARSSSSSN
NNSVADKFALSKAEQDEVLLVLREQFLHERQVTADDVRYVVRTIASQSSCRDLPSDFPPN
RWIAAFKRVHGFMQPDSNNAAAAAAARSNVRPYGDNGSRSSPHSSITSSAIEQGGNDVVH
SSRLPGPIARYSTTNNSRQSHSADSHSQMYASLSPPQQQQQQQQSSRGYAALPRSHSQNS
SNGAVYYDDYDDDGQMMHGSTSESDSENTRDSVMNDDMDDATGNGQRNSRQINAVSAETW
EKAMDAVEIHGMSLRNAAKAYGVHFAALHRRIKKRTRQKEAAPPLENYIPFEDEAGIVRV
IHARADLGVLMSYEELVDVLVRSKLKYVATVSAELSRSLIRRFQSRVEHSIRHLICDWPL
PRLDSLCRFGPPSPQLQLQLRQHDQYAMEEKVSPPPPLTPRALLSPALYQQNSHHGTSPF
YERTSPRVMEPPALLDDRLSISDPLLRPPPPMFQRENETHAAALPSISSPHGVMNGDRGL
PSSPTVVLRL
Download sequence
Identical sequences K3WYR7
PYU1_T010116 PYU1_T010118

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]