SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T010121 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T010121
Domain Number 1 Region: 7-52
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0000681
Family Psq domain 0.039
Further Details:      
 
Weak hits

Sequence:  PYU1_T010121
Domain Number - Region: 288-331
Classification Level Classification E-value
Superfamily Homeodomain-like 0.000239
Family Psq domain 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PYU1_T010121
Sequence length 526
Comment protein Name="PYU1_T010121" Note="Similar to clfA: Clumping factor A (Staphylococcus aureus (strain MRSA252))" AED:0.0597722960151803 QI:0|-1|0|1|-1|1|1|0|526
Sequence
MPQASPVSEKVWAQAIHAVIVEKLSLRRAAQLYGVHHMSLYRRVRGRNVGATASSRSTIS
TEFALSQAEQDEVLLVLRDQFLHGHQVTSDDVRYVVRTIASQSGRRDLPSGFPPNRWIAA
FKRVHGVMQPVSSTTAGAVAGSNVCRGHGVSGSRSSPHSSITSGAVEQGDNNAIKSSRLP
GATTMMYTATDSRQSLSVVSPSQMNASLAPPQKQQRQFSYGCVAVPRNHSCFSGSERAGN
GDDDDDSQTRHDSTSETDSESIRDSIVSDDMDDTRENDKRNCRQSNAVSTETWEKAMDAV
EIHGMSLRNAAKAYGVHYGALHRRVKKRARQEEAAQPPLDNYIPFEDEAGIVRVIHARAD
LGVLMSYEELVDVLVRTKLKYVAAVSAELSSWLIRQFQSRFEHSIRHLICYWPLPRLDSL
CRFGPQSAQLQLQLRQHGRYTMEKKLWSPPPLTPQALLSPASHQQNGYHNDVSSFDGHTG
SRNLESPTLLDGRARVSYPLVSSPRGGPTNRRRASSSSPSMVALRL
Download sequence
Identical sequences K3WYS2
PYU1_T010121

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]