SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T010186 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T010186
Domain Number 1 Region: 531-589,788-820
Classification Level Classification E-value
Superfamily EF-hand 0.00000000118
Family Calmodulin-like 0.053
Further Details:      
 
Domain Number 2 Region: 1783-1869
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.00000751
Family Synaptotagmin-like (S variant) 0.074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PYU1_T010186
Sequence length 1988
Comment protein Name="PYU1_T010186" Note="Similar to vps13D: Putative vacuolar protein sorting-associated protein 13D (Dictyostelium discoideum)" AED:0.232924536746934 QI:0|0|0|1|1|1|10|0|1988
Sequence
MWFWLGVLLLLALGVTTAFVAFGDALLTLLLRKYASQYVGDRILLFWSLRDGVLEINNIA
LAKDVLPAIEPMVGLPMDLERLELQQFAIELPLWNRFVMRTTGSKGMQSRIHIAGLQIGL
ALNKAEQWIWTREENLERFRQAVENAAKARLARVDSWTATIVQKLQQLVDARQAIREAKK
KKKVSGQASPAASESDAKPAFWHKLIDEIIDSFAIVVRRFVVTIRDDYSASGIGITFEKF
AIGRSHACETRRKRIVELNEFEIFANPRSRSRSDACYIIRPFSMIIGVYMPYIFQGLLMQ
FSNTQRALELEIMFSIDQPFMMQLRPAQVTFLMSLLHPIQFYYDWCNRACVQDDIACVEL
EEKDAIEYKSLYKEQWGLDHETSFFKRLYTNYKLKKEILERRVRLVELEANSPLEKYEKE
LPDVPPMFHTFSLAFMMPEMKMQLMDDSDKSMMLIDRNPDAITMLTLRVFQLGSSHIDVA
LELKDFSILIVFDPLISLMHVFLPAEDANVVKMREERDARIQKAKKDLEEKRYLEHLKAE
FRLRDTDGGGSLDVAEIESLLKSVANCQNLTKDEFNETAASNSSSAPELRMFVHTVISTA
FGGFYFRLLDDMLPMGLPALEVSLEELAVYGNFSMWEVGKISFDVYGKYYNMKARQIEPF
LEYYQGVLDLKKDPESHVDIVYTSDRYLQLNVTAAFMETVNSNLASFSKVEGSAERVRPH
IKEEDGLFWMLNESGVNLKYYVVAKKETKERHFAETVSAVVSVPSGEAHPCTLLNVDEEL
QEYEQQSLKEKQLRQAFRNADKDGSGELDTEEVRAVLREVYEEEERQRHPQQNDGKERFC
VLPPHGSMSIPINLVDAGSFAIRQIGETEWSNFLPLSTREQRLYKKLTRYEQQQAQKVQH
ENGGSSSSMSMTKMIKERMGSDVPLPNMNEYVPAGTEVVYPSLSCIDNQPTSVIEKISSN
NMQLGIWHLVIQPQLVLHNVLPCGVEYAIVQPEDCPKDSLDSHGEFQIVGSNSSSKRARA
VKALGQVDYFEFVNEVNSRRIGLDLKFKLPKGSMCTVEDHRAYFNGDKDIPMLKTKKYLP
KFERVDWSEPKDIASVGTYGELRPSGSGDFSFVLAYEKDEAAVVYTFVGKEKHWTGLRLR
DMVRDGVWKEMGDWSPNIPIKGVDEPHKTNDDYNVWTRGPLGDGPMVNIAVHMNDQTIFA
TLKDVSAKPSYRIENRSTRHSFRYVQRGVKNAEELILKPLESHSFVWDDPLAEALEVKIT
PLQWKVPTIVDFMLLGEIKNVTPNDIHGEVYIDESTRVLAIGDTRVFSGIRQQAFLSDWL
SNTLIDLAIHGVGITIVDTHPQEVLNITMESLRFTSSAGSRTCVFTLHHIQMDDMTPHAL
YPVILAPLDSGFNSDKREGWLPSEDERPFFSLTIDTAPKTGIAIFNNFDMVVNSLSVKLN
LEYVLGLVNLLLEFAPGSDEETMIQRGIDYKNTMLTLNISLPDEGVEGGMLLYFKKWKLS
PFDFHLVFDSSQEDRGEGISSILGSTLGSIIGGIAHVTPEFHFGEIVYRNTFFYEYDLVY
DVVWKIVLAVVGQWYKIVGSVEMLGDPVGLATEIVDGFALAGRQLKRDIRGQSLHKGQSA
ITLVQTVFGAPFGSIGKVSNGLGDVVKKATKFKSQESDEEPRHVPEGIFHGGVIFSKSIA
YGVTGFVKEPVRGAKRGGVKGFAKGVGRGTLQLIVSPVVGTLGVVEKVAQSVSNTTHLMD
EKRFDGGRRPARDLIMTPLKSLSDSNVITEIEIHCVYIDGLSENVNAQVVVDVHSQGGGG
PTRELGKYKSTTLRNHKGTPKFDQSWLIGITSLDTVIDINVFHKRKPMPKKLLGYIRFSV
EDIYRDFEAVPAKLLSDTKAKMRLKRRKRVRGSIISELARASSQPVEVRDESWKQKIRQT
SPSVLSDDVEDDSDSDSYEDDVEMLSNRSITVSEEYPPRPVAFELLDCASNAKMFLSIRY
VNDMRRYA
Download sequence
Identical sequences K3WYY7
PYU1_T010186

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]