SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T010195 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T010195
Domain Number 1 Region: 1-75
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000000000000102
Family Ubiquitin-related 0.0073
Further Details:      
 
Weak hits

Sequence:  PYU1_T010195
Domain Number - Region: 173-236
Classification Level Classification E-value
Superfamily JAB1/MPN domain 0.0222
Family JAB1/MPN domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PYU1_T010195
Sequence length 427
Comment protein Name="PYU1_T010195" Note="Similar to At3g63000: NPL4-like protein 1 (Arabidopsis thaliana)" AED:0.215803452855246 QI:0|-1|0|1|-1|1|1|0|427
Sequence
MLVRVRSKNGIWRVADLTPQSTVGDIKQWVKKQHAIALHTQQLALDQQQTHVARDQQTLQ
ELGVGHGDMLYLDYEGELVTTGGTVGTKISADGSLTHVTYHDRAGKNSFRPGLKALRDMK
MHWTLGEFMRMDAQFEYKISAQKSAHVSKVVLDAASCNDFQSYLRQFAFQQSRCGWLYGT
VNHETKEVTVDFIYEPPQEGDAFGFEVFDDPNADKVDAVAEALGREKVGWVFSHPPREEE
TFHFSAHEVMLAAQLQADAGGKESLFLTLKVTLDKQGQASFEAFQVSDQCVEMFSVGALV
EKEGDPQSCGVHDTFTALVEAKPAKEIDNNFFLCVVPVVTHESEMKCEFPKLNREGSYRT
RAALKEQLQKYRSEEYVKRISDFQLLIFLMDFLDPTTDIPAICQSIRNGVPLDSGYPILI
DSVAGTH
Download sequence
Identical sequences K3WYZ6
PYU1_T010195

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]