SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T010201 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T010201
Domain Number 1 Region: 116-173,210-322
Classification Level Classification E-value
Superfamily Bet v1-like 0.00000000000000348
Family STAR domain 0.092
Further Details:      
 
Domain Number 2 Region: 13-77
Classification Level Classification E-value
Superfamily PX domain 0.0000000288
Family PX domain 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PYU1_T010201
Sequence length 431
Comment protein Name="PYU1_T010201" Note="Protein of unknown function" AED:0.170152353447017 QI:0|0|0|0.66|1|1|3|0|431
Sequence
MAALSSGNTASTQEIIIERRYREFYAFALAVYSMFPSKDLWQRLPPKTLCFLKSSKNDGF
LLRRKNGLDDFIRCAIEMMDLGSSAQGTIGQWYLVRKFLNLPSTMLTQPTKDRSLVAAMY
ELKKHARQTQGWNLASCLEEHDAIYEKTCDGFQMMKRVRQCPFPARAVFDMIVKNNQGNV
TAPVSSAIQPTESIEYGSNGNSFATAASRSSNLVASWNPLVEHEEILRRDDGHTWVERTT
FKGGWVSPSMQMTSIKSWKVEDNGTIIVIMIPADDGVYDNQGNRVLHDSSRVDCIMGGWM
ITPTPKDETCTVTWLTQANFGECDPQSEFTGSQGLSALISRSVLLSWADEIVYLLSALER
SYSPSYYRHLGPLLSGGDFQKLKLKRRDTTGSCVNGDPRVYTLARELEPCLCLLIHKSTN
KNVLIFKTNLR
Download sequence
Identical sequences K3WZ02
PYU1_T010201

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]