SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T010264 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  PYU1_T010264
Domain Number - Region: 16-53,113-178
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.00229
Family Rhodopsin-like 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PYU1_T010264
Sequence length 232
Comment protein Name="PYU1_T010264" Note="Protein of unknown function" AED:0.0206611570247934 QI:0|-1|0|1|-1|0|1|0|232
Sequence
MLFLIVNAFAAVIACTVLLAALACATMLLPFCCVGVLVFRLLFRMRLVESLAKSDVMLVN
FLSRSEDRIAVEAASENNDPLHPLLRRPNSPLRLAPGLDNVSAESLLVLFYFLTIKCICS
LLGLCVVVLVLWAPVALLQLLFASVASSGDVTFWESICGVFTLSLVFAVAVFSLDMLVSL
SCATTCFFCCDGEVRTLNPHPRPAAVTKVHARPNVTVVRFAPSSASSCNESM
Download sequence
Identical sequences K3WZ65
PYU1_T010264

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]