SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T010296 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T010296
Domain Number 1 Region: 15-192
Classification Level Classification E-value
Superfamily eIF4e-like 2.49e-49
Family Translation initiation factor eIF4e 0.0000628
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PYU1_T010296
Sequence length 204
Comment protein Name="PYU1_T010296" Note="Similar to EIF4E2: Eukaryotic translation initiation factor 4E type 2 (Homo sapiens)" AED:0.00125156445556951 QI:42|0.8|0.83|1|1|1|6|142|204
Sequence
MAEDKQVEVKQQEVADEEHPLETGWALWYDKKLPKKIDVGTYQSNLQKIAQFNTVEDFWR
HYIHVKRPSQLSRDVNLYLFRDQPNCAPMWEAFPQGGCWILKIKKKANVLGKMWQDLVFA
AIGEVFASRDVVGIAMAIRSKEDMLSVWNADNSDDSTRFEIGEKLKEILMLDSNTLIEYK
FHANSIRDMSTFRNAKPYVFAATN
Download sequence
Identical sequences K3WZ97
PYU1_T010296

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]