SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T010300 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T010300
Domain Number 1 Region: 181-480
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 8.71e-61
Family Tandem AAA-ATPase domain 0.00017
Further Details:      
 
Domain Number 2 Region: 555-627
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 1.54e-16
Family GUCT domain 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PYU1_T010300
Sequence length 684
Comment protein Name="PYU1_T010300" Note="Similar to Os09g0520700: DEAD-box ATP-dependent RNA helicase 7 (Oryza sativa subsp. japonica)" AED:0.000729927007299347 QI:0|-1|0|1|-1|1|1|0|684
Sequence
MSLSREEEKSAKKAAKLAKKLAKEQAAADSSSEVEMKKEKKEKKEKKEKKEKKSKKRSRD
ADEEDEPVIATTSEESEVEAQPKKQKAKDGSAVPAVTQPVAEGENPPLENFRISEITQAA
LKKRGIASLFPIQAMTFDKIYDGKDLMGRARTGMGKTLAFALPVIELLLKNAKPLVRGRA
PRVVCMAPTRELAKQVATEFETTGPSLSTVCIYGGASYNSQNDAFRKGVDILVGTTGRVI
DHIDRGNLRLHNCEFLILDEADTMLEMGFREDVQKVFAAMEKVKNEQMKRQILLFSATIP
SWVKEVADKYMKKDREYVNLVKDSDNKASMDVQHIAIPCHWQGRPTLLANLLGIYAKKNS
RTIIFAETKKDCNELAVHPEIKQDAQVLHGDIAQDQRETTMKAFREGKLRLLIATDVAAR
GLDMNVDLVINSEPPRKASGNADVDTYVHRSGRTGRAGKKGICITLYTQRQLDAVQYIER
TIGNKFIMRGPPDQDDLIKVSAAKAIEEIEAVDPTMISLFEEKADELLESLGPQKALAAA
LACITGHTKPPRLTSLMSGVPDYVTVLFSSSNLIRAKGYVWNALNRDIPEEFAKDIKQMT
LTADSMGACFDLPVTALDLLNEKIAEQGTSCPYSIPKTVPALQQPAYMARSSGGRGGGGR
GFGGRGGGRGFGGGRGGGGRGRRF
Download sequence
Identical sequences K3WZA1
PYU1_T010300

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]