SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T010313 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T010313
Domain Number 1 Region: 21-217
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 2.77e-31
Family RNA methyltransferase FtsJ 0.00023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PYU1_T010313
Sequence length 265
Comment protein Name="PYU1_T010313" Note="Similar to FTSJ1: Putative ribosomal RNA methyltransferase 1 (Homo sapiens)" AED:0.0225563909774436 QI:0|0|0|0.5|1|1|2|0|265
Sequence
MAKSATDANRDIYYRRAKEVGFRARSAFKLLQLDEQFGILQNVHRAVDLCAAPGSWSQVL
SRKLYDPSVTTTIAEQEGDDAAANDVRIVSVDLQEMAPIPGVELVQGDITSKKTAEQIIS
YFKGKKAQVVVSDGAPDVTGVHDIDEFVQAELLAAALNITTHVLEEGGSFVAKIFRCQQY
DLLATQLKVFFASVSCSKPKSSRTQSNEAFVVCQGFKMPQNYTPVMTSYLLPRYGLSEGE
RYDPVLVPFLACGDLSGYDAIQQFE
Download sequence
Identical sequences K3WZB4
PYU1_T010313

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]