SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T010321 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T010321
Domain Number 1 Region: 145-208
Classification Level Classification E-value
Superfamily Homeodomain-like 0.000000000475
Family Centromere-binding 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PYU1_T010321
Sequence length 644
Comment protein Name="PYU1_T010321" Note="Similar to cbh2: CENP-B homolog protein 2 (Schizosaccharomyces pombe)" AED:0.0136344978831697 QI:0|-1|0|1|-1|1|1|0|644
Sequence
MSNLSAMNAMNLQQMNAAAALQQQMNAAAGLTSATSHLGPASASTTPNGKRSASASGARG
ASGGEVGGKKRRGEGAGNLTVEQKRRICEKHRSTPKITQKDLCRWAKLEFNLKKAPTQPT
MSNILKHEHLFKDNVGGVLGAERKTIRPTKHAHFDQVLANWVMERQNKGNITGDMIKTKG
RELVKQMGLDGKLGFSNGWLASFKARHGLIKRAGGNIGPHDKIMGSGMSGMNPDGTSGAN
LMEASGMALGGGVLSVDPNYMLPPVSMDLTLEQIQDTLRDYVPSDIYTVDETGLFYRAPP
NKLVQGDDAQSLLADEAKLTVLLAANADATDLMEPYIIGSILPPRNIKNASISQLGYHYV
CSSKSRMTVFIFQQWLRDFNARMASAHRNVVLLLDNAPSHVLGCVTLSNVRVIMFAPHLG
MKVQPMRGGILAAFKGKYRLKHLTLAIDHLEDGLSDIYRLTQLQAMRWITEAWQQTSKEA
IINAWKPLGVSVPFPFDAAMDGSDDKNVEEELWGLLYCLQLSGVVNTKVLVNSRWENDIH
KRLNEDMIEDPQENEEEFRIPEPTPLDPSGVADHHLHHDEEGGNGVQPLTAKEQLKSFRD
VIRYLERTGTPDVRDPQLLSVVEFLKKKQLSLRFDNASSTTLTI
Download sequence
Identical sequences K3WZC2
PYU1_T010321

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]