SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T010358 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T010358
Domain Number 1 Region: 504-773,801-876
Classification Level Classification E-value
Superfamily DNase I-like 2.49e-35
Family Inositol polyphosphate 5-phosphatase (IPP5) 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PYU1_T010358
Sequence length 1067
Comment protein Name="PYU1_T010358" Note="Similar to INPPL1: Phosphatidylinositol-3,4,5-trisphosphate 5-phosphatase 2 (Homo sapiens)" AED:0.214460900777087 QI:0|-1|0|1|-1|1|1|0|1067
Sequence
MASPQRTSQRNRSTRAFSQIEDPAMLRQLDHPMTPPIRLSSPVAAPGKTVEIRRLVSPSR
SPQRSVGDAARTPPSTPPSTPPPSRLVASGKPPMPSKLASPNSSAGTSTTTAASSLQLPP
QSERAHTRENPVAGLPPPPPQPIRDTSEWRETANRLSQRVKELELENFRLKASGSSGNLR
KLSRSFVAAPPKTFAGGEMSALLSATKAAEAEDALEYHNGSSGPASTTTAAATKRGTILK
SKSYAAELGHTGSGFTVAEAALASHRSRSKRTASTAAAPPQLSAAGANPLVDKLRAGYWN
GNNVKSSFSCNNLADMDRRDIAVEKLNLLLQPPAPAPAPPQVLPPAPIPKKKLPSAAPPL
LEKANSTNTRGVTRGNRDAAALMKSFSRGKDSFLRAGSGSSSNIVLDNDFGATHQQQLAI
ATSFHAPEAMLRRSSSSFQSIVDTVVDDDDTSVSELSEAYTPSSQHRITSPRSLREADFL
TNGSLASSRGKTAATKPKTLMKRPNSTDVRMWVGTWNMGAADPFADGNGILDEQRSGAML
QHLLPHGCQLYVLGVQEGVNENVYHAVEAYLNRNERGTRYYRLELRNSNCLLVNKNHPID
AVIDAVHGRGDGAFMGTKFTGLAVFVSADVQDKVKLMRVGVHKFNITSGSKGGVAVALLI
NNTTMVFVNCHLDARNDTYRREQVRNLNANLGKIMGHYSFDLTEQFHHVVWMGDMNYRIV
HLDPQMVLHMLAEGRNLELHDKFDGLLNDRRTSGIFEGFTEPNKFPDFYPTYKKLPKRGF
VNESLPSWPTLVYRVLYKEPFYKGGKVKKRVPGWCDRILVHSLLVSDSKLMPEKVESPFD
DQPTWIDNYRSVNHGNGMDVSDHSPVFATFVLSFPCLGKDKSGAKLSPHRMSRRSNRSHS
TFSDGRSTPEFRQQSVTESYFDQPKVVRHINSVRPVSTVLIVSNMQLYWNDKALVPKKTR
VVAPLVGEDLKQCDVIGERCQEAFALSLSLNALIQHSRPLEQLHMLVWVKNDSIVGHCTL
SLKRIARQEEGGEVRFRVPLYNNSMRLYHEGHPLLVVFSVRAKTFAK
Download sequence
Identical sequences K3WZF9
PYU1_T010358

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]