SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T010359 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T010359
Domain Number 1 Region: 116-522
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 7.19e-84
Family Regulator of chromosome condensation RCC1 0.0000163
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PYU1_T010359
Sequence length 529
Comment protein Name="PYU1_T010359" Note="Similar to rcc1: Regulator of chromosome condensation (Xenopus laevis)" AED:0.117167153866596 QI:0|-1|0|1|-1|1|1|0|529
Sequence
MSGKRARADGGISKEQYDAQDAFSAAPSTTGFEAFPRASESVLQTRKIVAKGSSSAANAT
TLTRASESHRQFTALNRAFAANIKAQWQHNKRGDWLENMKEYIVYARDITSKFGAQEGQV
LTFGSGDCGQLGHGVEEDDDMMVKFPRVLQALSTKHIVRVACGGLHTGAIAASGEVYTWG
CNDDGALGRVGEENFPAEVEGFGPAAACAVQIVGGDCHTAVVTLTGQVYTWGSYKDKEGK
QWCDAATPSASFKQKQVRPFLIKGVNNAVDVRCGSSFNVVRTNEGHVYSWGLGEMGQLGR
EVNAEMKDATTGDYLVDMVFHDHLTPARMMLGKEPLPAVKAIGCGSYHSLVALAANGYLY
TTGLNNYGQLGIGSTENQVKLQLVDDLATKNIASVEGGTHHSVVLTNDGDVYTFGRADSG
QLGAQDTCQTGDFKDRPQKVEFLGAKEKIVVRAIAAGSNHALVLTEQNAIYSWGYGDMLA
LGNGVEQDETRPRLVDWRKTSFGNAEILQIDAGGQHSAVLARTTAGKST
Download sequence
Identical sequences K3WZG0
PYU1_T010359

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]