SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T010423 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T010423
Domain Number 1 Region: 358-407
Classification Level Classification E-value
Superfamily DEK C-terminal domain 0.000000942
Family DEK C-terminal domain 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PYU1_T010423
Sequence length 408
Comment protein Name="PYU1_T010423" Note="Similar to Dek: Protein DEK (Mus musculus)" AED:0.279376498800959 QI:0|0.16|0.14|0.28|1|1|7|24|408
Sequence
MSDTKDVEAVAPAPPQEEQQQQQEQQQQEEETHVPVHDVTATTVEGARVRRSTQKFVPVE
RKADEPDEFTPPVGSGTKVKDIPVVGESVAALGKKNVEILKALYTAMYSRRFQIKNLKVI
KEHMLEFSGIPDQDAKSRELLFAKLNKWLRPFLNQIMDVLGVERSKKSFDDEGKLFDKDA
LVNRLIEWLYNPHAKKGGLKPPTPKVAAKKTKKTTKKEVKAPAKRKSTAKESAAKKKQKT
TTTKKVKAASVEDEEDDEEEDEVSEPSGDESESDYDDDDKKKASKKKKKPAAKKKTTATR
KPKSKQIVKDDDEDEDMDNAEEEEKKNETSGSNKENEKDVAVSTDEKPSSGSSSSGLDAD
VKAKVKEIIAQGNAEELTVKKIVRQLSEELGRDLSSEKNAIKEFIREA
Download sequence
Identical sequences K3WZM4
PYU1_T010423

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]