SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T010454 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  PYU1_T010454
Domain Number - Region: 160-263
Classification Level Classification E-value
Superfamily Tropomyosin 0.00915
Family Tropomyosin 0.0056
Further Details:      
 
Domain Number - Region: 6-49
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.0133
Family Calponin-homology domain, CH-domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PYU1_T010454
Sequence length 268
Comment protein Name="PYU1_T010454" Note="Similar to CLUAP1: Clusterin-associated protein 1 (Homo sapiens)" AED:0.28056768558952 QI:0|-1|0|1|-1|1|1|0|268
Sequence
MSFRELRNLTEMMRALGYPRPISVENFRKPNFELVSDMLYWMVKKYDPSSSVTEEIDTEE
DRIEFLTQVASEVLAKARIRLNPKKLYAADGFAVKELIKLARVLYKASRIDVLKLEANDD
DDDDVSVKSLLGSRVKDPKATRQLSSDITQSGAKLFDLLEAELDVRDARQHALRFLDAIS
NNSENSSEQKYLERSIKEILQQTQENVEMTERQCEELEAEEKALASKMKKAQTDLERSEK
RLKSLQHVRPAFMDEYEKLEKELERQYA
Download sequence
Identical sequences K3WZQ5
PYU1_T010454

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]