SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T010456 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T010456
Domain Number 1 Region: 286-402
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.00000000000000208
Family PLC-like (P variant) 0.073
Further Details:      
 
Domain Number 2 Region: 415-480
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000000528
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PYU1_T010456
Sequence length 486
Comment protein Name="PYU1_T010456" Note="Similar to FAM172A: UPF0528 protein FAM172A (Gallus gallus)" AED:0.0233154808526853 QI:0|0.5|0.2|0.6|1|1|5|0|486
Sequence
MRRLSSRAGKNFSMKSEEDMEELMQTLVAQIQLKLKNELQLREIFIPNSKAEARCNIFVS
ANYATCPKLCVFMQPGQGMQPGIWSRTIHPKTGFQGSMIPYLKTAIQGGYGVVILNPSTN
SAMINGHRAKILHSATPEDHVAYVWKNYVQPNAAQEISFIVHDAAGVLLKTFLGTLSSKD
ERRIGGIAFIESAHQVSSGDTNNVRHLLRDKAVNFEASTEAMFAVIGSSKARLGCVSLSV
GRTSGEANNREWTVHSVQTSAFVFLQSITNGIEESLHAIRATFPNKLVVTVNRARLTGQP
YNNPFAVIQCVGQKKETVGSHKHTMDPEWNQTFSFPVTSSEEKVVVLVKDRTFPLYSTLG
QVAIRMSDVGLNRAERRWFALRDEKVNTLHGNGEVELTLEWVHDTFVARSDSVIRENRTM
NSNLEHSSSRGARVNGTGDDGCYMCKKPFVLHRKRYCRMCLRLVCTSCSERLFLPGFSEP
KRRENS
Download sequence
Identical sequences K3WZQ7
PYU1_T010456

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]