SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T010475 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T010475
Domain Number 1 Region: 22-161,198-307
Classification Level Classification E-value
Superfamily DHS-like NAD/FAD-binding domain 2.2e-72
Family Sir2 family of transcriptional regulators 0.0000611
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PYU1_T010475
Sequence length 311
Comment protein Name="PYU1_T010475" Note="Similar to npdA: NAD-dependent deacetylase (Xanthomonas axonopodis pv. citri)" AED:0.0512820512820513 QI:0|1|0|1|1|1|2|0|311
Sequence
MQSHVLKQSGGAIASQLEAAALAADVSKLKSFLDAGRGRTVLLTGAGISTDSGIPDYRGA
NGVYMRNKDFKPLQYQEFVKAHTYRQRYWARSFLGWPKILHAQPNASHDAVTQLQQHAVV
SDILTQNVDRLHSKSGAKGVLELHGCLHEVECTNCRSVVKRQEYQEKLAEMNPKVAQWSI
LHPDKDSGDVASSVNPDGDVDITWNYDDFAYPPCLQCGGIMKPKVVFFGENMPVVVKNQS
FEHVDKADALLVVGSSLQVFSAMRLLNRARERKIPIAIVNLGPTRGDDACDLRLDTHCTD
VLATVAHDFSL
Download sequence
Identical sequences K3WZS6
PYU1_T010475

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]