SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T010479 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  PYU1_T010479
Domain Number - Region: 162-197
Classification Level Classification E-value
Superfamily WW domain 0.00139
Family WW domain 0.005
Further Details:      
 
Domain Number - Region: 620-699
Classification Level Classification E-value
Superfamily ATP synthase D chain-like 0.0902
Family ATP synthase D chain-like 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PYU1_T010479
Sequence length 1230
Comment protein Name="PYU1_T010479" Note="Similar to TCHH: Trichohyalin (Oryctolagus cuniculus)" AED:0.00406438235467133 QI:0|0|0|0.5|0|0|2|0|1230
Sequence
MESGEEPLVAVDDPNAAATAFASFATALEALVAGTQHQLVHKVMGQTTRLVHCEQTMQRA
LETNRILLESKRVTVEQQQREIEDLEARVRTLQSRLNKEKRERDEEKKWLTQLWPDGLVL
PTLLKPYEVANDLEYIEDTKQRLQALVNRRVMRERVRRQVEASQHWKMVVEPATDDVAEQ
VYYMNEITGQSVWQAPLAMVYEPPMQWDIAKKDWKDSYGLEHFYPVSTDVEGNDVESDDS
DGADSARVKTATPSRRNRSDDEEETEEQDEEDMPADPVALRAQMTEEMEKAKQLQLDLAK
SQAQQRSCALQLLNASRESFEREKEALAEEDEAKRDIERKKRKARLQEQAASNAKAAAQE
KKTSNSVQSKFGKDSVGKKDLTFSKDDEQLERELDEFVLQERADRPYLTVPIALDPRVKL
RHQLDDEYVHMKAMEAKALEIEQLEFDLLEKSSLRHEESTAKEEELFAFCDEIRSRQPEV
QQDLDSAVKAITRLEIPLSPPSEPRPSAEQLEQASGRYVTLQGLDNGDDGDDDDAAEKSN
ASDAEREVVTSPDVVQSQERERVASEVAKENMTSEEVAALLRDEEELLLFKSYVDAEQRW
RDWEREEVVRLEELAQATERRKALEVLQRQLAIDLALYESDAPFFARVGELEKELNTRMW
QIQADSQIERVRFMIERAAREEAIFQMDDRFEELQVQLEAAQRLPMQALNALEHLDLEMR
SRELCDSLAKQISRLQERYEKEMAAKALLTELETRSYEYAFTKLQEEVHLFGEKQTLLDL
NVALGDDLQESRKTIERLYLLIHDQPESPSEPLIDNQRLLSLSQQREDATAVIEGKLQYL
QQARQFLMTCYDREARWRSLASIALVKDCSSEEWMTTMQRERHESMMAILQEQHDTEVLE
LKKQIKLLQKVKTALHFQIDELTGKLDRMRLAYQESSDHVRQQTECVIRALTEESEQEKR
KFCDEKTRAQEARERLIREHGPIREELEQRLLELEGMNEKQCHWLTAAKRELNAQRSANK
ELVKAYQSLEKRRAAETNDMRFRIASQIKKINNIEMWNLSLKLKAKEAHAERIQMQKEMA
LQVQHHKQQQQLLRLKNWRHRVTAQAILTDVDLLFRFFADGFEILSGTTSEINAALRENG
AIEVIAALAQHCHQAPVKAICAKALGQLAWNANATKRSLGWNAKRKWFDWVSTQSEMVLQ
KLNHENKPFDAVAEEETAEMNWLADTSNVP
Download sequence
Identical sequences K3WZT0
PYU1_T010479

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]