SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T010492 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T010492
Domain Number 1 Region: 118-212
Classification Level Classification E-value
Superfamily Homeodomain-like 1.65e-30
Family Myb/SANT domain 0.00089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PYU1_T010492
Sequence length 537
Comment protein Name="PYU1_T010492" Note="Similar to mybA: Myb-like protein A (Dictyostelium discoideum)" AED:0.239080027574105 QI:8|0|0|0.57|1|0.85|7|1|537
Sequence
MNRKLEMLDLDENDVVVDMRGMPMNNMSNMHNMHSMNSMMNTMGHHHPQQHDMSLLDASG
SHGNAQDMNYLRPAHDAHSPPKYGDLMDDPYDEDDDDGDESGTKGELRRSSKPADSNSKR
PWTREENEKLMQLVKQYGAKRWSLIAMHLPGRVGKQCRERWHNHLNPSVRKDAWTAEEDY
VIFECHKNVGNQWAEISKMLPGRTDNAIKNRYYSTMRRMQRQSIRKKGSMREGKSIRVAT
VNSSPLSSGGASSTRGTPQHQQEPPPPPQLQRNIPLQAPSTFQKLFNNNQNSPMGRERTD
GSMMSDFESRTTSPPSRHHSLVYPMTSGYASNAMGSEMHHHQSSSGMGPGPDASFDYVPM
QSSQQQQQQHRMRANSVPNQSLMQMSMMQQHSYAPPPYSPHPPPSETSPINTQGPPQQQQ
QHSHYRMSEQPINLPHKRIIDEMQGSQRDAWKHDSPVSVTARIFRPTPSQQQQQSQYPHS
PAHDTLGNHPSVGSPANAMGGMHSPSMHGVDSFKAASGVPSLYRPAPSMSHFGGNMD
Download sequence
Identical sequences K3WZU3
PYU1_T010492

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]