SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T010583 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T010583
Domain Number 1 Region: 195-240
Classification Level Classification E-value
Superfamily SMAD/FHA domain 0.00000249
Family FHA domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PYU1_T010583
Sequence length 434
Comment protein Name="PYU1_T010583" Note="Protein of unknown function" AED:0.511480983230705 QI:0|0.23|0.21|0.78|1|1|14|44|434
Sequence
MTASAATAESNPQQQQKATHSRTASKKEEAMDEYMAPAAGRKRHLDEIAPPLSSDGPAVT
GTPAKMPHHSNLSSAHSQQQYPLLMCTGTAPGARNFQPMQSPLFRDQQHNAVLANMSSTP
AHGPSGGIRSGHMNMMDVQNKSPKKAPAKTRRMSDFSIYPSIPLFKKSPVRSPDWESQCT
TTNCSENAGVMPVSVMVENTSTNGLEINKRAMKNGERRELHVGDTVTLLEIRTGVHVRIA
NPFTRTLSDNEQSFQKALTGNSKDANGMPVKLEKQEFLEFVEQDNSVASNLIVVYTRSKS
IEKEIGEVFACLKVAKEKVQQEDMKRQVISKFMAQVEELLLSFPSLTRKFPGVQILITVR
QDMKLNLYHSSLVSERIVQVNGLSEVDSAAVLLALAKLNLSQEQRKKWILPVKYLKNVSN
SAYTTVIMAHDYSS
Download sequence
Identical sequences K3X034
PYU1_T010583

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]