SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T010593 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T010593
Domain Number 1 Region: 235-377
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 6.31e-19
Family N-6 DNA Methylase-like 0.07
Further Details:      
 
Domain Number 2 Region: 117-198
Classification Level Classification E-value
Superfamily THUMP domain-like 0.0000000113
Family THUMP domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PYU1_T010593
Sequence length 401
Comment protein Name="PYU1_T010593" Note="Similar to THUMPD3: THUMP domain-containing protein 3 (Bos taurus)" AED:0.149756105466155 QI:0|0.25|0|0.4|1|1|5|0|401
Sequence
MVKTLDAAMDAAMDVPVPTYLLLVMRGMEWLVEKEIRRKLQVTYLEICSVQNDPARKNMN
VMQGEAAVGRILLRTTSTPAEVMKLQSVQATLAFLVQSDAVITDRAAGLEQMAKLVTDAD
WEPALRLWRAHFPSADAAPKKPAFRGSCVRDGRHAYRSMEVAGEIGSAVIDKFGWDVNLV
AFDLEIVCILYHNFMITGISLADTSKIKFCSRLANEDRKGVTADVKYISTLRPSTTYLMF
QLAEYKVGEIFLDSMCGVGTIPIWCAEFADNNLFALGGELDDLAVSKAGQNAATSVRNTN
IMQWDATALPLRSQSIDKVIVDMPFGVRCGNHRINNKIYPKLMKELIRVLRDGGRAVILV
MSKKLFLSSFQHLPFRVAQVHEVNIGGLAGGIYVLEKTSVY
Download sequence
Identical sequences K3X044
PYU1_T010593

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]