SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T010594 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T010594
Domain Number 1 Region: 80-139
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00000000403
Family Centromere-binding 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PYU1_T010594
Sequence length 793
Comment protein Name="PYU1_T010594" Note="Similar to Tigd2: Tigger transposable element-derived protein 2 (Mus musculus)" AED:0.0517744817978414 QI:0|-1|0|1|-1|1|1|0|793
Sequence
MAGKGRGKRLTDSERMEIIARLEDKTTPLSRAKCARIYGVTPAAISKLMKVSQTVKKRYS
DAGADAGHLRDKRQRGGFSKNMCFEDELYKWICSIRARKIPLLVAHVQQKAKLLASKHHM
NDDFKASNGWYYRFCARYGLAPGSLHAGGGSTGGVSNDNCAVVASNVINSGITNGTERLT
GDDCNGVAATLRMNVAGGRNDGNDDERATNNDMKNHVAWSDDPETSEQMSALQATVKQYG
PEFVYSLSEARLFYRLLPAQLDPVRGDESSCAHKGTNDDGTDENKDSSKGNTERVLVLVC
ANGTGTHKIPLLVVGKHARPSCFVAATVTPHGHHQFENHASLLMQTGDTKYFSQREVWCD
NQTFQYWCTNVFLPAIQQHTTQRVLLLMDNPGGNLEKCEHPAMNTYFLPTRAGNVSGNTL
LQVGGPNSQSKHTHAAQFQPMQHGVIRELKRRYKIAVFQEMLSFYEKSDEERYRLLQRAL
KRPQGAAGIAFGRLPHVLDAMRLLSDVWRAIPIELLRSGWVRSSLYAEGFPDVNLDSHHP
DISDDTIVHELCAMLRKVRAVDELHGLPKEIRLWMYADDDSSERMQQELLHDVQRLLQEE
EEEIKLSGGGNGEPDAKAVPHPPLMGSSNVGGCAFEVPVLHPMPTTHLQHPDMPPPMYID
HTNMMHYGYHQQQHAHQHPFPPQQQQQQHGSPALLREKRKTINFVFRALSNAEEALDSAD
VAEYFGDDATNEAAGALQAVLRRLRRVQRGKQSSLPAPAAATADADAARSGDNGANDSGA
TAAHSYFYGGALR
Download sequence
Identical sequences K3X045
PYU1_T010594

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]