SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T010686 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T010686
Domain Number 1 Region: 114-222
Classification Level Classification E-value
Superfamily PX domain 0.0000000000000183
Family PX domain 0.0062
Further Details:      
 
Domain Number 2 Region: 241-337
Classification Level Classification E-value
Superfamily DUSP-like 0.0000000000379
Family DUSP, domain in ubiquitin-specific proteases 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PYU1_T010686
Sequence length 672
Comment protein Name="PYU1_T010686" Note="Protein of unknown function" AED:1 QI:0|-1|0|0|-1|1|1|0|672
Sequence
MGVLAVLKAKEVVANAYDELQVPVGAPPEQLVATFRVACLRKALQMDNSSSNLSSNGRGD
EDDAFQRQAVAYRFLYSLPLLNQTEYTAQHIFGTLRPLTPVTGEEANERASAMLDVAITS
MEQAQRAWGLPYTNYVISVHYWLRKHVVRRRYSEFATLHAVLQTKLPVLPMLPPRAWAYK
MRMPNDDGARAQALTQYLMRVVTMLANRGLFSLDVMDFLEIDYRRVRAEEEALAVEYLAR
SASSNVYYIVCCGWLDAWKKFLYTGDGEDADKDAECAATAHHGPPPGKISNGHLVDISTG
APKDHLMPARHYRCVNSVTWTYLRTIYGVDGPTLARSSPDIYEKPVVDLVTLAVTTQHLV
RGFLGRRAAKARKQYVLLQDPDMERRMVRIERQARLDERMAVVRKYVNVKEYQTRHIAAI
KIQRAFRMFLLRAEHKLLMAESVVPEVADNFQQIDEYLSLDEIGVVRDPQLRLAHFLITM
NKGVPLQKLRSRRKTPKWRLFKINQIGSQLLWSSKKRSHALAFVNVVHLAIEAPVVLKSG
FGRRKPVAQSQGVVVTYRDGSSASSEAENNSKPSHGEIHELILMCESACECEALHFGLRA
LVAETTTRISNGASYVDGHGMIRRKYPHAKRLIRDARALMEQKSTTSGDEAAANKEALQR
ASIVISGPPTRA
Download sequence
Identical sequences K3X0D7
PYU1_T010686

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]