SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T010688 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T010688
Domain Number 1 Region: 27-77
Classification Level Classification E-value
Superfamily Leucine zipper domain 0.0000113
Family Leucine zipper domain 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PYU1_T010688
Sequence length 311
Comment protein Name="PYU1_T010688" Note="Protein of unknown function" AED:0.0689102564102564 QI:0|-1|0|1|-1|1|1|0|311
Sequence
MQIHPTSSRAELASPVVADKELEMAKLDRKRSQDRLHQRRHRAKRKQQLSALEQDVKDLQ
MSVAQLGQKRQRLNNSFAGHCSPMSSVQSIEENKKSRVDDATKIVREYFQVFKYGHSAIH
QDAQEQFLHRVLKPDVVGVDMRGVNAFVEQWRLSGSFFWSMLLEAKSMTARSSGDLTIVE
VDADVHLRFRADLATVLCPQLVHHEELLKTIVDNVICVGAKYTFIVEQDGQVSGLLVEIE
FINALCRVLGSLIKASQVIEGAQISMGSGTINCKLPVVPVEPCRQPKVKKTQKSPALNYR
LQLNYLLSSSS
Download sequence
Identical sequences K3X0D9
PYU1_T010688

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]