SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T010751 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T010751
Domain Number 1 Region: 213-273
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00000173
Family Centromere-binding 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PYU1_T010751
Sequence length 370
Comment protein Name="PYU1_T010751" Note="Similar to z: Regulatory protein zeste (Drosophila melanogaster)" AED:0.290178571428571 QI:0|1|0.5|1|1|1|2|119|370
Sequence
MAGKIPTAEEVIALVAAGDGGMQQLIAQAQAQQAQALAEAQAQAVAQAQAQHHALVQHAV
ASAADAAMADVHMAVDSAALGVHGGKMDASAMEFMPLSGATVVDNAHSMGGDLASAAAPG
DVESSMDGGTANGGNNISSNSLAIKRKSIPLSMKKEAIEWIMGPGKGIPSRAEKHFSALH
WDVSASSFRKWWKNRDKILGDSSHKKRITGGGRKPYLENSEEKLLVIVIQERAKKDRVTR
KWIAKTAQHMFQRTNANFKASENWVTKFIRRNGLTLKRSYVTYEQQQQPPLSGAAALVAD
EDGHLEIDDDDDGEDAGAGGVDATGIDESMGVDGVVEQASDHSRDPELHDDGAAGAAEVH
EDEERKTVLV
Download sequence
Identical sequences K3X0K2
PYU1_T010751

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]