SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T010765 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T010765
Domain Number 1 Region: 232-349
Classification Level Classification E-value
Superfamily Cyclin-like 0.000000113
Family Cyclin 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PYU1_T010765
Sequence length 406
Comment protein Name="PYU1_T010765" Note="Similar to CCNY: Cyclin-Y (Homo sapiens)" AED:0.0373966035218936 QI:0|1|0|1|1|1|2|0|406
Sequence
MVVGSSRMTEAAALSVSLSPLLPSSIEEDARAVNGSVAGGKRVHFGAFQPTHTVFTPRLT
ETTSLRYRKPDDRVVSSTSLAPPTSVSSIAQPNYDDFLRRVSVVLYQHLRRCEKRHREEQ
RAAAAAAAAAATAAAEAATLAPDSTSVSMQGTNGALVSVHNGVAGAQSISGGREDDDDLA
PEDDTVDYPAPAAKVNPSIASPRLVELPVDEIFREEHFVTPQYKYTFIRLPRVFPMTSYV
MEKVSSKRHVPSVDEIFRFCMNLFNKAQLSAECTIVCLIYIERLMEQANVPLLAVTWKPI
VLCGLLLASKVWQDLSSWNVEISNIYPQYPLHSINRLERLFLHHIQWDLYISASVYAKYY
FALRSLTEKKDFRRRYNYTMRVEPPNSRRLEERSAAIKSELYSKSL
Download sequence
Identical sequences K3X0L6
PYU1_T010765

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]