SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T010773 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T010773
Domain Number 1 Region: 3-90
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 8.73e-22
Family Canonical RBD 0.0021
Further Details:      
 
Domain Number 2 Region: 133-157
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0000183
Family CCCH zinc finger 0.0034
Further Details:      
 
Weak hits

Sequence:  PYU1_T010773
Domain Number - Region: 182-206
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.000196
Family CCCH zinc finger 0.0063
Further Details:      
 
Domain Number - Region: 101-125
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.000222
Family CCCH zinc finger 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PYU1_T010773
Sequence length 457
Comment protein Name="PYU1_T010773" Note="Similar to Os03g0826400: Zinc finger CCCH domain-containing protein 25 (Oryza sativa subsp. japonica)" AED:1 QI:0|-1|0|0|-1|1|1|0|457
Sequence
MRDNDSQKIIVVGIPKTMDDSALSELFSGFGTVADAKVVLDANTKQSRGFGFVTFTAGSA
MRKAIQDMNKKVVEGRTLNVRQLVPKDKFQSEKKDDASQDPSKRPCWLLRKGKCTKGDQC
PFSHETKNGEFGSCFEFMQTGECKRGDKCIFSHGSRENADSNDSESTQAKPREAPLKQEG
GEQKRVCFAFQKGKCHRGKKCLYLHEKVPEMVNDQPVVPPTKQEAAPAKRSEFEVVAPVE
AGKKRSRDVDSHDDDDGNEQEVDDDETGSEDDNDEEDEEEQTPQQKTAPARAAPPARASR
QSKPAEKRPRSEDAKPFEKRQRPENGKPFVKREYPAKNGDSKDLSKYGGNGYAQRYTEKQ
LKQKKQNNKNALQRQNAKNRPKGPQQAQPQRPKRAEAVDMGAAFDSDDDRKPRGKKRVAD
KAQQKANREKLQQERKVKRDAKKSALSRLQTKESIEL
Download sequence
Identical sequences K3X0M4
PYU1_T010773

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]