SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T010835 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T010835
Domain Number 1 Region: 270-374
Classification Level Classification E-value
Superfamily DUSP-like 4.18e-18
Family DUSP, domain in ubiquitin-specific proteases 0.0022
Further Details:      
 
Domain Number 2 Region: 40-77,121-194
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.0000000000255
Family Synaptotagmin-like (S variant) 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PYU1_T010835
Sequence length 407
Comment protein Name="PYU1_T010835" Note="Similar to USP20: Ubiquitin carboxyl-terminal hydrolase 20 (Homo sapiens)" AED:0.0144559256945945 QI:0|1|0.66|1|1|1|3|221|407
Sequence
MSKAYAATERDRFGAVPLSPRQNDPLIVPGSASLDAMASGCMAISLRVVAATSLRAMKKG
LTSNPYCEISLVHHDGSSQHREHNAWHMGQDLSIDQKISGSQSSQPGLSREMAQMTTRSK
PFRTKIVKSSLNPIWDFDVDFGDVDTETVVGVVFTVKHGEKFGMVKKDIGELFLSLREIM
DLKMQPPHEQSFHLQPTEEILLREAQEGPSSRKYGKLVVRVNTYGVTRADAPASGSANYT
TITELRPSDMSETSFAHEDDFSKSDKKMQLHDIKAEVRKLKTLHQTRPNPGEMWYAISAK
WIQDWLLFASKYKGDEKYSPGSIDNMCLVSDNLLNGTFQIRTDLSIKKDFRMINRASWDF
YQEKYEGGPAIEVRIPPDCENTSVWIYDIKLHEVGRVGTNYVGSDSD
Download sequence
Identical sequences K3X0T6
PYU1_T010835

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]