SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T010846 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T010846
Domain Number 1 Region: 5-56
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.43e-20
Family Ribosomal protein L24e 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PYU1_T010846
Sequence length 171
Comment protein Name="PYU1_T010846" Note="Similar to rlp24: Probable ribosome biogenesis protein RLP24 (Dictyostelium discoideum)" AED:0.0770491803278688 QI:0|-1|0|1|-1|1|1|0|171
Sequence
MRIHTCYFCSSPVYPGHGMTFVRNDSKIFRFCRSKCHKNFNRKRNPRKVKWTKSFRKAAG
KEMALDTTFDFEKLRNRAVKYDRELMGATIHAIERVQQIKEKREERFYNNRMKASKGFAK
ERDLRELEQNISLIEPDAVAAFKDQAQLNVASSKQKDSAKENGASSMVLDQ
Download sequence
Identical sequences K3X0U7
PYU1_T010846

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]