SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T010879 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  PYU1_T010879
Domain Number - Region: 164-207
Classification Level Classification E-value
Superfamily Leucine zipper domain 0.0304
Family Leucine zipper domain 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PYU1_T010879
Sequence length 556
Comment protein Name="PYU1_T010879" Note="Protein of unknown function" AED:0.142728904847397 QI:0|-1|0|1|-1|1|1|0|556
Sequence
MLRMQDLVNAGGYADAAEDGDDRDADASTSSVAASANVRLPPLADRAHVAQNASTTTFRD
AWPPLVDHHTHHDQDERKSPAALSRSDCRVRKRVLERHLSFDDHDSLDGGIHDEPAVKAA
HFDNDATWSPTAFTSGLAVLSAQACNSTPSSANVAPSPVEADGTRRRQQLKEASQRCRKR
QKHESMAYTTEINRLRQKIVLLRSKFEAPALPSIEENRSASHHMFQMKRHLGLLKKKLSD
HHCWLQSIRSLLASAPLFDFAVHLAKDLHRFSSQSATASSSMLPPDFKYLNEWREDCEQQ
KFSRVLMAQRVKNVVRASSQNASNLLKQYTSRDAQFQRNFVSRGWTICTSAKNELLAFRC
QRQFPHGVSAKDVAFKLWRSIQRDDILRTFVPIVQGSILVHESDTCSISRRLIQCTTHEP
QQTSVTVESIIFVAGCNAEAWQISIQTIEDHYLCLLAAEKADEPASPMISPASMRAQTST
DTEQPSSSKFKRNNHFVIAAQILQNKHGASVELAGCTQHDVPPAHPDEDASLDLLRYFVS
LLPVYEELHLTQGRNA
Download sequence
Identical sequences K3X0Y0
PYU1_T010879

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]