SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T010922 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T010922
Domain Number 1 Region: 41-208
Classification Level Classification E-value
Superfamily Bet v1-like 0.0000033
Family STAR domain 0.021
Further Details:      
 
Domain Number 2 Region: 260-320
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00000612
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PYU1_T010922
Sequence length 441
Comment protein Name="PYU1_T010922" Note="Protein of unknown function" AED:0.140702771493213 QI:0|1|0|1|1|1|2|0|441
Sequence
MPPTPPQQITLNRAEQDEYDKLASQLLDKTLVQYSQFNGLIDTGEWSLVRKRKQISIYRS
VLDSDDPNVTIMAGSGLIHGSLEDVMDGLYCDTTADLRTVKTLLHYKLVNGSVLNVSERR
SAAEPFQFAGIKWVAAKASWGLTKHRDLLTYERMGRTLDKNGNELAFYALYSIDRPECPP
DSVKGIKRSKISTCNVFKRLPDNRVEVFAWGEFPDIGSMSHRVAEYVIAGTWLRIVYSVD
CAEAKKCSKLMARSAGRSVAATKACHVCRKSTSKFKTRLRCAGCSQTMCKTCSCDRVIFE
INMRTGKPMEKRFCKLCINKVAAAPVIQPISQHPFYTEPARGNERVEEPRPKSKSLSATG
YPWIEPSGNEASIEKVALAVDEEEDWTTSKLCNFDLRIDTQAICENEIERKHPAASNQMV
VRDPPLSKSIRQSHIESRTFQ
Download sequence
Identical sequences K3X123
PYU1_T010922

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]