SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T010924 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T010924
Domain Number 1 Region: 265-325
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00000419
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.026
Further Details:      
 
Weak hits

Sequence:  PYU1_T010924
Domain Number - Region: 40-214
Classification Level Classification E-value
Superfamily Bet v1-like 0.00302
Family STAR domain 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PYU1_T010924
Sequence length 334
Comment protein Name="PYU1_T010924" Note="Protein of unknown function" AED:0.027860696517413 QI:0|0|0|1|0.5|0.33|3|0|334
Sequence
MSADPFERFPYIRLARREQLRYDHMAADVLRSCLNQYSRLHGVIDTNDWVPVRRRKQMTI
FRGLEYSGDPRVTIMTGTGLIHGSLEDVMDGLYCDTHANIRTVTTLLKQKYVDGGVFHVN
ERRTPDAPFRFAGIKWLAVKAPWGMAKHRDLLTYERMGTTVDADGNELAFHVLQSIERPE
WPAGCVKGIKREYTSTCYLYRRHSANRVQCFLWSNVRDLNSIGRRLAEYVTAGALLNVVN
TVACAEARKCSKLMIRSNGRACPPSNACHICKKTPGLFDTQRQCAGCKQIVCKSCSAYRP
VFKIDSRSGKPMEARFCKLCSNKAHCRHQKNQPL
Download sequence
Identical sequences K3X125
PYU1_T010924

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]