SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T010934 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  PYU1_T010934
Domain Number - Region: 293-350
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00161
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.04
Further Details:      
 
Domain Number - Region: 69-233
Classification Level Classification E-value
Superfamily Bet v1-like 0.00256
Family STAR domain 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PYU1_T010934
Sequence length 513
Comment protein Name="PYU1_T010934" Note="Protein of unknown function" AED:0.154669260700389 QI:0|-1|0|1|-1|1|1|0|513
Sequence
MSESAGHNSYAVPPPTAVGADPRVSSSWRSSSQLFPTIHLTKEEQIHYDVTVGRVLQRTL
TEYENFRGQVNKDNWELVRKRKQMSIYRNLQGLGNPRVTLMMGTGLIPGTVEEVMDGLYS
DNTDDLRAVRSLIRYKFVDGGVFHVCESRTPEAPYRFAGIKWTAAKAPLGGTLIKNRDLL
TYERMGMTTDANGNEIAYHILQSINRPEWPADCIKNIRRAYTSTCYLFRRRNNVVECFLW
GEYYANGHVVQKLADYGVCGLWMNVLYAPQCSEAKRLTQLMARATPGTISLSGSCDNCHQ
RPGYFDKLRPCAGCRQRICKGCTTVRKIFKLDWYTKTILTEKFCLLCVTSVTNRSVTVPG
RFGDAHSVSSTSDSNYGANEEYEGNERVSKLRRGPTSAPQLHNRTTLTSTFQSSAVGNLR
TSHIVPRPSSLGSGDNNEEETFELTEANLRNFELGMSMVERETTTALDEEPKIVGPEDIS
TNDTEGPIMERDGHDRYFVDMYTTNERAGRASV
Download sequence
Identical sequences K3X135
PYU1_T010934

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]