SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T010986 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T010986
Domain Number 1 Region: 121-213
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 1.02e-16
Family Canonical RBD 0.0043
Further Details:      
 
Domain Number 2 Region: 21-82
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.0000909
Family Canonical RBD 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PYU1_T010986
Sequence length 218
Comment protein Name="PYU1_T010986" Note="Similar to RNPC3: RNA-binding protein 40 (Bos taurus)" AED:0.399091845690083 QI:2|0.16|0|0.28|1|0.85|7|1|218
Sequence
LLHAAEIKSYIRATVEKDDLLYVFGHVLPSTMDLSAICIELAAASGTATITYPIEAFATE
ALTKLHGVALESQPLIVSYATAVETETNSPDVPMKIECDLPLRLSIADLDTLRLKPSAFA
EEKVMGKYQRGEPSTTLYVKNLAKDIQESELRAVFGAVLPVDTRVDTIKIRHFTEGRMKC
QAFVEYPSVSLATLALDKIHGVVFKDKPLVVNLNNKAA
Download sequence
Identical sequences K3X187
PYU1_T010986

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]