SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T011007 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T011007
Domain Number 1 Region: 279-570
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.23e-63
Family Protein kinases, catalytic subunit 0.0000578
Further Details:      
 
Weak hits

Sequence:  PYU1_T011007
Domain Number - Region: 24-251
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.0022
Family Rhodopsin-like 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PYU1_T011007
Sequence length 848
Comment protein Name="PYU1_T011007" Note="Similar to drkD: Probable serine/threonine-protein kinase drkD (Dictyostelium discoideum)" AED:0.214750055282528 QI:0|0|0|0.75|1|1|4|0|848
Sequence
MEQLDSSVALRFTVIAAAATASSLVVTTLYGRMRKTAHRATEALFFSVILTDWLFACSGV
VAHVMRLVMGDAVMTQGVAGVAVDSIFNLSFLATIVWSPILAAFVLTGGNSKFFVRTSWL
VAWTLGGIYGFAWADELQVSADGGATSESLRAARAHDFLRYFETMVFAVSLVLVLVAACV
LYGRKFGFLEPSPRLLLQEKLLQYVIVVTLLQLPYMISTWVGRNNTPDAILHIADCLIFS
VPVLNAYMYGVQPKCWRITPPTTEEIIDEVNVYAADKVTLEELDGLSDIKFIAEGAAGSV
YKARWLGIDVAMKVIKLPNPVGEDKALYETMIQNSEHAFIEEASICARLRHPNIMLFIRA
GHYEGKLGILTEYCARGSLKDVLKMHFPLQWRRKVELALHVAKGLTYLHARNPTYIHRDL
KGTNILVTDTWQAKLADFGISKVANFVNRTETTNPELTLRNNQTVFDELTSFAGTWRWNA
PEILMDPQNCRYSRATDMYSFGMVLWEIATDGAIPFSDVQFDFEVRDRVVREERPQINPA
HRVPEMFRVLITKCWAQDPTHRPSATQATVALTALLETMGKDRTGAQSFLTSSDGNSSSI
FTSFRGTQSGRGQHRQSHFFGARITNLFRGRFSTRHSTRSSTRSEGPDETFAKYMSPHST
SIEVSPSNDNVAILDQPVTRIRGLSRGFEARLSSLREYDMEANPSDISTAFSSSSAESIM
SPIIELPIDAMLEAGGTYIDDRSEDGRSLCSELDSSHGRTDDSLEASNGSSRKHSLNSSG
STWGNSSKISNGHWGLHSNGSNTRSSAVERLRREYDDIHNFDDTVGSFMGSRIVGDFKKT
EHGVAAFL
Download sequence
Identical sequences K3X1A8
PYU1_T011007

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]