SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T011080 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T011080
Domain Number 1 Region: 53-268
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 3.27e-40
Family beta-lactamase inhibitor protein-II, BLIP-II 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PYU1_T011080
Sequence length 322
Comment protein Name="PYU1_T011080" Note="Similar to Rcbtb2: RCC1 and BTB domain-containing protein 2 (Mus musculus)" AED:0.232198142414861 QI:0|-1|0|1|-1|1|1|0|322
Sequence
MLEINQLFAQEDEAALGFKDPRTAALSPAVDLDEEGDCVGLLDGKKLLARAKIIADVASI
KQIVAGNDFAMAITTAGETFAWGLSLLGQGQLSPSKLPWTSTEKAMRIACGLNHVLVATK
TGAAYSWGSNLYGQLGHSKSCSLTDPPVREPTAIRLSGLASTASRTFGVLDVACGGDHSV
LLADSGDVYCFGNNWQGQLGLNPEITETGCVYEPMRVELVPDKDPSSEAIENNKQTQNPS
ARTYLISAYGSTTAAVTTRGDVFVWGQCVPTGPESVCGLVSRWEPQRLNLSPLEEDLKGA
HAVYQSIAIANGLVVLTTHKDE
Download sequence
Identical sequences K3X1I1
PYU1_T011080

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]