SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T011086 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  PYU1_T011086
Domain Number - Region: 32-154
Classification Level Classification E-value
Superfamily Rhomboid-like 0.0706
Family Rhomboid-like 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PYU1_T011086
Sequence length 200
Comment protein Name="PYU1_T011086" Note="Similar to Plac8l1: PLAC8-like protein 1 (Mus musculus)" AED:0.144876325088339 QI:0|-1|0|1|-1|1|1|0|200
Sequence
MDSDAVYTIQIDKREAYEGRRRRSASTTPRAPAPGGPAWETGLFGFGDAPWTHCFLALVL
PCAIASNIEAMIDRSSYGIGAFFMGIAFLGEIVCVTQSYQDGAVDHTAWTREYSDETLPI
SMWSLAAVICGIMYAAGVFAFRNMTRHYYRIPGSCCLDVVIAMCCSPCSMAQLSRHFKIA
GPSAYADEALDTLPAYESST
Download sequence
Identical sequences K3X1I7
PYU1_T011086

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]