SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T011121 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T011121
Domain Number 1 Region: 126-172
Classification Level Classification E-value
Superfamily Leucine zipper domain 0.00000162
Family Leucine zipper domain 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PYU1_T011121
Sequence length 391
Comment protein Name="PYU1_T011121" Note="Similar to prp5: Pre-mRNA-processing ATP-dependent RNA helicase prp5 (Aspergillus fumigatus)" AED:0.205877464300168 QI:0|-1|0|1|-1|1|1|0|391
Sequence
MVERHYAQLRSMARHFRPDDRSSGEQEGRMSGYVPDSSHRPSYQRAYLDEEEYVDLEERR
RSGQDRELPYAHDQSRVNAMRDERERFFRMDQVTLEFSRSSNSSDAFSDAMLDSSSTSSD
PMVSKKARRKEQCRVNQANYRKRKRMYETKLSGQIKILEDEIQELQARKVALGTTAPTLL
PVTAAAQTPTAVSSNDPIASIGDFYHALESAPWEVFPLNEHRGQGGHQQRLQYPALRTLF
DRQQQEFESMESFQWQWLWYREHFDVFHLLVTSSERLDAGDQVIIRISAQLHLQIQQSSM
KIEREEEKEELWRGRSGRSFNGKGRRGWDAKTLVCPVLQQFEFHFMEREMTRITSEIDWI
AGVTALVNCPPEYTLAFLDEFIDRTVDRVVA
Download sequence
Identical sequences K3X1M2
PYU1_T011121

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]